![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
![]() | Protein automated matches [190509] (15 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
![]() | Domain d5l5pe_: 5l5p E: [325751] Other proteins in same PDB: d5l5pa_, d5l5pb_, d5l5pf_, d5l5pg_, d5l5ph_, d5l5pi_, d5l5pj_, d5l5pk_, d5l5pl_, d5l5pm_, d5l5pn_, d5l5po_, d5l5pp_, d5l5pt_, d5l5pu_, d5l5pv_, d5l5pw_, d5l5px_, d5l5py_, d5l5pz_ automated match to d4g4se_ complexed with 79l, cl, mes, mg |
PDB Entry: 5l5p (more details), 2.8 Å
SCOPe Domain Sequences for d5l5pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5pe_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l5pe_: