Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l67b_: 5l67 B: [325743] Other proteins in same PDB: d5l67a_, d5l67c_, d5l67d_, d5l67e_, d5l67g_, d5l67i_, d5l67j_, d5l67l_, d5l67o_, d5l67q_, d5l67r_, d5l67s_, d5l67u_, d5l67w_, d5l67x_, d5l67z_ automated match to d1z7qc1 complexed with 39v, cl, mes, mg |
PDB Entry: 5l67 (more details), 2.6 Å
SCOPe Domain Sequences for d5l67b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l67b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l67b_: