SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l5wq_ (5l5w Q:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (12 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (89 PDB entries)
  8. 2282440Domain d5l5wq_: 5l5w Q: [325741]
    Other proteins in same PDB: d5l5wa_, d5l5wb_, d5l5wf_, d5l5wh_, d5l5wi_, d5l5wj_, d5l5wk_, d5l5wl_, d5l5wm_, d5l5wn_, d5l5wo_, d5l5wp_, d5l5wt_, d5l5wv_, d5l5ww_, d5l5wx_, d5l5wy_, d5l5wz_
    automated match to d1iruf_
    complexed with cl, mg

Details for d5l5wq_

PDB Entry: 5l5w (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133)
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5wq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5wq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5l5wq_:

Click to download the PDB-style file with coordinates for d5l5wq_.
(The format of our PDB-style files is described here.)

Timeline for d5l5wq_:

  • d5l5wq_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12