Lineage for d5l6bt_ (5l6b T:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2282415Domain d5l6bt_: 5l6b T: [325716]
    Other proteins in same PDB: d5l6ba_, d5l6bc_, d5l6bd_, d5l6be_, d5l6bg_, d5l6bi_, d5l6bj_, d5l6bk_, d5l6bl_, d5l6bn_, d5l6bo_, d5l6bq_, d5l6br_, d5l6bs_, d5l6bu_, d5l6bw_, d5l6bx_, d5l6by_, d5l6bz_
    automated match to d4g4sg_
    complexed with 04c, cl, mes, mg

Details for d5l6bt_

PDB Entry: 5l6b (more details), 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with onx 0914
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l6bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6bt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l6bt_:

Click to download the PDB-style file with coordinates for d5l6bt_.
(The format of our PDB-style files is described here.)

Timeline for d5l6bt_:

  • d5l6bt_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12