![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein Proteasome beta subunit (catalytic) [56252] (7 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (177 PDB entries) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) |
![]() | Domain d5l6ci_: 5l6c I: [325693] Other proteins in same PDB: d5l6cb_, d5l6cc_, d5l6cd_, d5l6ce_, d5l6cf_, d5l6cg_, d5l6ch_, d5l6ck_, d5l6cl_, d5l6cm_, d5l6cp_, d5l6cq_, d5l6cr_, d5l6cs_, d5l6ct_, d5l6cu_, d5l6cv_, d5l6cy_, d5l6cz_ automated match to d1g0ui_ complexed with 6nv, cl, mes, mg |
PDB Entry: 5l6c (more details), 2.6 Å
SCOPe Domain Sequences for d5l6ci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l6ci_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals gwgavvyiikkdevvkrylkmrqd
Timeline for d5l6ci_: