Lineage for d5l6cq_ (5l6c Q:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282387Domain d5l6cq_: 5l6c Q: [325688]
    Other proteins in same PDB: d5l6ca_, d5l6cb_, d5l6cf_, d5l6cg_, d5l6ch_, d5l6ci_, d5l6cj_, d5l6ck_, d5l6cl_, d5l6cm_, d5l6cn_, d5l6co_, d5l6cp_, d5l6ct_, d5l6cu_, d5l6cv_, d5l6cw_, d5l6cx_, d5l6cy_, d5l6cz_
    automated match to d1iruf_
    complexed with 6nv, cl, mes, mg

Details for d5l6cq_

PDB Entry: 5l6c (more details), 2.6 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 18
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l6cq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6cq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5l6cq_:

Click to download the PDB-style file with coordinates for d5l6cq_.
(The format of our PDB-style files is described here.)

Timeline for d5l6cq_:

  • d5l6cq_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12