Lineage for d5l5jr_ (5l5j R:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2202407Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2282381Domain d5l5jr_: 5l5j R: [325682]
    Other proteins in same PDB: d5l5ja_, d5l5je_, d5l5jh_, d5l5ji_, d5l5jj_, d5l5jm_, d5l5jn_, d5l5jo_, d5l5js_, d5l5jv_, d5l5jw_, d5l5jx_
    automated match to d1iruf_
    complexed with 6n5, cl, mes, mg

Details for d5l5jr_

PDB Entry: 5l5j (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 14
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l5jr_:

Sequence, based on SEQRES records: (download)

>d5l5jr_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l5jr_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l5jr_:

Click to download the PDB-style file with coordinates for d5l5jr_.
(The format of our PDB-style files is described here.)

Timeline for d5l5jr_:

  • d5l5jr_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12