Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l61v_: 5l61 V: [325678] Other proteins in same PDB: d5l61a_, d5l61c_, d5l61d_, d5l61e_, d5l61g_, d5l61i_, d5l61j_, d5l61k_, d5l61l_, d5l61n_, d5l61o_, d5l61q_, d5l61r_, d5l61s_, d5l61u_, d5l61w_, d5l61x_, d5l61y_, d5l61z_ automated match to d4r17h_ complexed with 6n5, cl, mes, mg |
PDB Entry: 5l61 (more details), 2.8 Å
SCOPe Domain Sequences for d5l61v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l61v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l61v_: