Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l6cp_: 5l6c P: [325655] Other proteins in same PDB: d5l6ca_, d5l6cc1, d5l6cc2, d5l6cd_, d5l6ce_, d5l6cg_, d5l6ci_, d5l6cj_, d5l6ck_, d5l6cl_, d5l6cn_, d5l6co_, d5l6cq1, d5l6cq2, d5l6cr_, d5l6cs_, d5l6cu_, d5l6cw_, d5l6cx_, d5l6cy_, d5l6cz_ automated match to d1z7qc1 complexed with 6nv, cl, mes, mg |
PDB Entry: 5l6c (more details), 2.6 Å
SCOPe Domain Sequences for d5l6cp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l6cp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l6cp_:
View in 3D Domains from other chains: (mouse over for more information) d5l6ca_, d5l6cb_, d5l6cc1, d5l6cc2, d5l6cd_, d5l6ce_, d5l6cf_, d5l6cg_, d5l6ch_, d5l6ci_, d5l6cj_, d5l6ck_, d5l6cl_, d5l6cm_, d5l6cn_, d5l6co_, d5l6cq1, d5l6cq2, d5l6cr_, d5l6cs_, d5l6ct_, d5l6cu_, d5l6cv_, d5l6cw_, d5l6cx_, d5l6cy_, d5l6cz_ |