SCOPe 2.08: Domain d3rlaa_: 3rla A:

Lineage for d3rlaa_ (3rla A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
   Uniprot P07824

8. Domain d3rlaa_: 3rla A: [32564]
   complexed with mn

Details for d3rlaa_

PDB Entry: 3rla, 2.54 Å

PDB Description: altering the binuclear manganese cluster of arginase diminishes thermostability and catalytic function

PDB Compounds: (A:) arginase

SCOPe Domain Sequences for d3rlaa_:

Sequence; same for both SEQRES and ATOM records:

>d3rlaa_ c.42.1.1 (A:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdnsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

Timeline for d3rlaa_:

• d3rlaa_ first appeared (with stable ids) in SCOP 1.55
  
• d3rlaa_ appears in SCOPe 2.07