Lineage for d5l68b_ (5l68 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994733Domain d5l68b_: 5l68 B: [325620]
    Other proteins in same PDB: d5l68a_, d5l68c1, d5l68c2, d5l68d_, d5l68e_, d5l68g_, d5l68i_, d5l68j_, d5l68k_, d5l68l_, d5l68n_, d5l68o_, d5l68q1, d5l68q2, d5l68r_, d5l68s_, d5l68u_, d5l68w_, d5l68x_, d5l68y_, d5l68z_
    automated match to d1z7qc1
    complexed with 6n5, cl, mes, mg

Details for d5l68b_

PDB Entry: 5l68 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 14
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l68b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l68b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l68b_:

Click to download the PDB-style file with coordinates for d5l68b_.
(The format of our PDB-style files is described here.)

Timeline for d5l68b_: