Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l68b_: 5l68 B: [325620] Other proteins in same PDB: d5l68a_, d5l68c1, d5l68c2, d5l68d_, d5l68e_, d5l68g_, d5l68i_, d5l68j_, d5l68k_, d5l68l_, d5l68n_, d5l68o_, d5l68q1, d5l68q2, d5l68r_, d5l68s_, d5l68u_, d5l68w_, d5l68x_, d5l68y_, d5l68z_ automated match to d1z7qc1 complexed with 6n5, cl, mes, mg |
PDB Entry: 5l68 (more details), 2.8 Å
SCOPe Domain Sequences for d5l68b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l68b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l68b_:
View in 3D Domains from other chains: (mouse over for more information) d5l68a_, d5l68c1, d5l68c2, d5l68d_, d5l68e_, d5l68f_, d5l68g_, d5l68h_, d5l68i_, d5l68j_, d5l68k_, d5l68l_, d5l68m_, d5l68n_, d5l68o_, d5l68p_, d5l68q1, d5l68q2, d5l68r_, d5l68s_, d5l68t_, d5l68u_, d5l68v_, d5l68w_, d5l68x_, d5l68y_, d5l68z_ |