Lineage for d5l68q_ (5l68 Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230899Domain d5l68q_: 5l68 Q: [325618]
    Other proteins in same PDB: d5l68a_, d5l68b_, d5l68f_, d5l68g_, d5l68h_, d5l68i_, d5l68j_, d5l68k_, d5l68l_, d5l68m_, d5l68n_, d5l68o_, d5l68p_, d5l68t_, d5l68u_, d5l68v_, d5l68w_, d5l68x_, d5l68y_, d5l68z_
    automated match to d1iruf_
    complexed with 6n5, cl, mes, mg

Details for d5l68q_

PDB Entry: 5l68 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 14
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l68q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l68q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5l68q_:

Click to download the PDB-style file with coordinates for d5l68q_.
(The format of our PDB-style files is described here.)

Timeline for d5l68q_: