Lineage for d5l5hh_ (5l5h H:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2282311Domain d5l5hh_: 5l5h H: [325612]
    Other proteins in same PDB: d5l5ha_, d5l5hb_, d5l5hc_, d5l5hd_, d5l5hf_, d5l5hg_, d5l5hi_, d5l5hj_, d5l5hk_, d5l5hl_, d5l5ho_, d5l5hp_, d5l5hq_, d5l5hr_, d5l5ht_, d5l5hu_, d5l5hw_, d5l5hx_, d5l5hy_, d5l5hz_
    automated match to d4r17h_
    complexed with 39v, cl, mes, mg

Details for d5l5hh_

PDB Entry: 5l5h (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with pr-924
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5hh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5hh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l5hh_:

Click to download the PDB-style file with coordinates for d5l5hh_.
(The format of our PDB-style files is described here.)

Timeline for d5l5hh_:

  • d5l5hh_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12