![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 protein domains) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (156 PDB entries) |
![]() | Domain d5l5of_: 5l5o F: [325605] Other proteins in same PDB: d5l5oa_, d5l5oc_, d5l5od_, d5l5oe_, d5l5og_, d5l5oi_, d5l5oj_, d5l5ok_, d5l5ol_, d5l5on_, d5l5oo_, d5l5oq_, d5l5or_, d5l5os_, d5l5ou_, d5l5ow_, d5l5ox_, d5l5oy_, d5l5oz_ automated match to d4g4sg_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l5o (more details), 2.6 Å
SCOPe Domain Sequences for d5l5of_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5of_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d5l5of_: