Lineage for d5l5bh_ (5l5b H:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2282276Domain d5l5bh_: 5l5b H: [325577]
    Other proteins in same PDB: d5l5ba_, d5l5bb_, d5l5bc_, d5l5bd_, d5l5bf_, d5l5bg_, d5l5bi_, d5l5bj_, d5l5bk_, d5l5bl_, d5l5bn_, d5l5bo_, d5l5bp_, d5l5bq_, d5l5br_, d5l5bt_, d5l5bu_, d5l5bw_, d5l5bx_, d5l5by_, d5l5bz_
    automated match to d4r17h_
    complexed with cl, mg

Details for d5l5bh_

PDB Entry: 5l5b (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133)
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5bh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l5bh_:

Click to download the PDB-style file with coordinates for d5l5bh_.
(The format of our PDB-style files is described here.)

Timeline for d5l5bh_:

  • d5l5bh_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12