Lineage for d5l5zv_ (5l5z V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994421Domain d5l5zv_: 5l5z V: [325574]
    Other proteins in same PDB: d5l5za_, d5l5zc1, d5l5zc2, d5l5zd_, d5l5ze_, d5l5zg_, d5l5zi_, d5l5zj_, d5l5zk_, d5l5zl_, d5l5zn_, d5l5zo_, d5l5zq1, d5l5zq2, d5l5zr_, d5l5zs_, d5l5zu_, d5l5zw_, d5l5zx_, d5l5zy_, d5l5zz_
    automated match to d4r17h_
    complexed with bo2, cl, mg

Details for d5l5zv_

PDB Entry: 5l5z (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with bortezomib
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5zv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5zv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l5zv_:

Click to download the PDB-style file with coordinates for d5l5zv_.
(The format of our PDB-style files is described here.)

Timeline for d5l5zv_: