SCOPe 2.08: Domain d5l5hq1: 5l5h Q:1-234

Lineage for d5l5hq1 (5l5h Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)

8. Domain d5l5hq1: 5l5h Q:1-234 [325559]
   Other proteins in same PDB: d5l5ha_, d5l5hc2, d5l5hh_, d5l5hi_, d5l5hj_, d5l5hm_, d5l5hn_, d5l5ho_, d5l5hq2, d5l5hv_, d5l5hw_, d5l5hx_
   automated match to d1iruf_
   complexed with 39v, cl, mes, mg

Details for d5l5hq1

PDB Entry: 5l5h, 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with pr-924

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5hq1:

Sequence; same for both SEQRES and ATOM records:

>d5l5hq1 d.153.1.4 (Q:1-234) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5l5hq1:

• d5l5hq1 first appeared in SCOPe 2.06, called d5l5hq_
  
• d5l5hq1 was called d5l5hq_ in SCOPe 2.07