Lineage for d5l5as_ (5l5a S:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2282256Domain d5l5as_: 5l5a S: [325557]
    Other proteins in same PDB: d5l5aa_, d5l5ab_, d5l5ac_, d5l5ad_, d5l5af_, d5l5ag_, d5l5ai_, d5l5aj_, d5l5ak_, d5l5al_, d5l5an_, d5l5ao_, d5l5ap_, d5l5aq_, d5l5ar_, d5l5at_, d5l5au_, d5l5aw_, d5l5ax_, d5l5ay_, d5l5az_
    automated match to d4g4se_
    complexed with cl, mg

Details for d5l5as_

PDB Entry: 5l5a (more details), 2.4 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; r57t)
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5as_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5as_ d.153.1.4 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l5as_:

Click to download the PDB-style file with coordinates for d5l5as_.
(The format of our PDB-style files is described here.)

Timeline for d5l5as_:

  • d5l5as_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-11