Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species) contains an extension to the common fold at the N-terminus |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries) |
Domain d5l5hg_: 5l5h G: [325551] Other proteins in same PDB: d5l5ha_, d5l5he_, d5l5hh_, d5l5hi_, d5l5hj_, d5l5hm_, d5l5hn_, d5l5ho_, d5l5hs_, d5l5hv_, d5l5hw_, d5l5hx_ automated match to d1irua_ complexed with 39v, cl, mes, mg |
PDB Entry: 5l5h (more details), 2.6 Å
SCOPe Domain Sequences for d5l5hg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5hg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d5l5hg_: