SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l5yo_ (5l5y O:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2202517Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2202526Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2282237Domain d5l5yo_: 5l5y O: [325538]
    Other proteins in same PDB: d5l5yb_, d5l5yc_, d5l5yd_, d5l5ye_, d5l5yf_, d5l5yg_, d5l5yh_, d5l5yk_, d5l5yl_, d5l5ym_, d5l5yp_, d5l5yq_, d5l5yr_, d5l5ys_, d5l5yt_, d5l5yu_, d5l5yv_, d5l5yy_, d5l5yz_
    automated match to d1jd2v_
    complexed with 3bv, cl, mes, mg

Details for d5l5yo_

PDB Entry: 5l5y (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with carfilzomib
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5l5yo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5yo_ d.153.1.4 (O:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d5l5yo_:

Click to download the PDB-style file with coordinates for d5l5yo_.
(The format of our PDB-style files is described here.)

Timeline for d5l5yo_:

  • d5l5yo_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-11