Lineage for d5l5sd_ (5l5s D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282236Domain d5l5sd_: 5l5s D: [325537]
    Other proteins in same PDB: d5l5sa_, d5l5sb_, d5l5sf_, d5l5sg_, d5l5sh_, d5l5si_, d5l5sj_, d5l5sk_, d5l5sl_, d5l5sm_, d5l5sn_, d5l5so_, d5l5sp_, d5l5st_, d5l5su_, d5l5sv_, d5l5sw_, d5l5sx_, d5l5sy_, d5l5sz_
    automated match to d1iruf_
    complexed with 39v, cl, mg

Details for d5l5sd_

PDB Entry: 5l5s (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with pr-924
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l5sd_:

Sequence, based on SEQRES records: (download)

>d5l5sd_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l5sd_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l5sd_:

Click to download the PDB-style file with coordinates for d5l5sd_.
(The format of our PDB-style files is described here.)

Timeline for d5l5sd_:

  • d5l5sd_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-11