Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l5or_: 5l5o R: [325535] Other proteins in same PDB: d5l5oa_, d5l5ob_, d5l5oc2, d5l5of_, d5l5og_, d5l5oh_, d5l5oi_, d5l5oj_, d5l5ok_, d5l5ol_, d5l5om_, d5l5on_, d5l5oo_, d5l5op_, d5l5oq2, d5l5ot_, d5l5ou_, d5l5ov_, d5l5ow_, d5l5ox_, d5l5oy_, d5l5oz_ automated match to d1iruf_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l5o (more details), 2.6 Å
SCOPe Domain Sequences for d5l5or_:
Sequence, based on SEQRES records: (download)
>d5l5or_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
>d5l5or_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
Timeline for d5l5or_:
View in 3D Domains from other chains: (mouse over for more information) d5l5oa_, d5l5ob_, d5l5oc1, d5l5oc2, d5l5od_, d5l5oe_, d5l5of_, d5l5og_, d5l5oh_, d5l5oi_, d5l5oj_, d5l5ok_, d5l5ol_, d5l5om_, d5l5on_, d5l5oo_, d5l5op_, d5l5oq1, d5l5oq2, d5l5os_, d5l5ot_, d5l5ou_, d5l5ov_, d5l5ow_, d5l5ox_, d5l5oy_, d5l5oz_ |