Lineage for d5l5hf_ (5l5h F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2202407Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2282220Domain d5l5hf_: 5l5h F: [325521]
    Other proteins in same PDB: d5l5ha_, d5l5he_, d5l5hh_, d5l5hi_, d5l5hj_, d5l5hm_, d5l5hn_, d5l5ho_, d5l5hs_, d5l5hv_, d5l5hw_, d5l5hx_
    automated match to d4g4sg_
    complexed with 39v, cl, mes, mg

Details for d5l5hf_

PDB Entry: 5l5h (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with pr-924
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l5hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5hf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l5hf_:

Click to download the PDB-style file with coordinates for d5l5hf_.
(The format of our PDB-style files is described here.)

Timeline for d5l5hf_:

  • d5l5hf_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-11