Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries) |
Domain d5l5bt_: 5l5b T: [325516] Other proteins in same PDB: d5l5ba_, d5l5bc2, d5l5bh_, d5l5bi_, d5l5bj_, d5l5bm_, d5l5bn_, d5l5bo_, d5l5bq2, d5l5bv_, d5l5bw_, d5l5bx_ automated match to d4g4sg_ complexed with cl, mg |
PDB Entry: 5l5b (more details), 2.8 Å
SCOPe Domain Sequences for d5l5bt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5bt_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d5l5bt_:
View in 3D Domains from other chains: (mouse over for more information) d5l5ba_, d5l5bb_, d5l5bc1, d5l5bc2, d5l5bd_, d5l5be_, d5l5bf_, d5l5bg_, d5l5bh_, d5l5bi_, d5l5bj_, d5l5bk_, d5l5bl_, d5l5bm_, d5l5bn_, d5l5bo_, d5l5bp_, d5l5bq1, d5l5bq2, d5l5br_, d5l5bs_, d5l5bu_, d5l5bv_, d5l5bw_, d5l5bx_, d5l5by_, d5l5bz_ |