Lineage for d5l5bt_ (5l5b T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990638Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2990683Domain d5l5bt_: 5l5b T: [325516]
    Other proteins in same PDB: d5l5ba_, d5l5bc2, d5l5bh_, d5l5bi_, d5l5bj_, d5l5bm_, d5l5bn_, d5l5bo_, d5l5bq2, d5l5bv_, d5l5bw_, d5l5bx_
    automated match to d4g4sg_
    complexed with cl, mg

Details for d5l5bt_

PDB Entry: 5l5b (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133)
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l5bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5bt_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l5bt_:

Click to download the PDB-style file with coordinates for d5l5bt_.
(The format of our PDB-style files is described here.)

Timeline for d5l5bt_: