Lineage for d5l5wu_ (5l5w U:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282214Domain d5l5wu_: 5l5w U: [325515]
    Other proteins in same PDB: d5l5wa_, d5l5wb_, d5l5wf_, d5l5wh_, d5l5wi_, d5l5wj_, d5l5wk_, d5l5wl_, d5l5wm_, d5l5wn_, d5l5wo_, d5l5wp_, d5l5wt_, d5l5wv_, d5l5ww_, d5l5wx_, d5l5wy_, d5l5wz_
    automated match to d1irua_
    complexed with cl, mg

Details for d5l5wu_

PDB Entry: 5l5w (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133)
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5l5wu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5wu_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d5l5wu_:

Click to download the PDB-style file with coordinates for d5l5wu_.
(The format of our PDB-style files is described here.)

Timeline for d5l5wu_:

  • d5l5wu_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-11