SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l5jg_ (5l5j G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2201437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2282207Domain d5l5jg_: 5l5j G: [325508]
    Other proteins in same PDB: d5l5ja_, d5l5je_, d5l5jh_, d5l5ji_, d5l5jj_, d5l5jm_, d5l5jn_, d5l5jo_, d5l5js_, d5l5jv_, d5l5jw_, d5l5jx_
    automated match to d1g0ug_
    complexed with 6n5, cl, mes, mg

Details for d5l5jg_

PDB Entry: 5l5j (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 14
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5l5jg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5jg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d5l5jg_:

Click to download the PDB-style file with coordinates for d5l5jg_.
(The format of our PDB-style files is described here.)

Timeline for d5l5jg_:

  • d5l5jg_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-11