Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l5hv_: 5l5h V: [325475] Other proteins in same PDB: d5l5ha_, d5l5hb_, d5l5hc1, d5l5hc2, d5l5hd_, d5l5he_, d5l5hf_, d5l5hg_, d5l5hi_, d5l5hj_, d5l5hk_, d5l5hl_, d5l5hm_, d5l5hn_, d5l5ho_, d5l5hp_, d5l5hq1, d5l5hq2, d5l5hr_, d5l5hs_, d5l5ht_, d5l5hu_, d5l5hw_, d5l5hx_, d5l5hy_, d5l5hz_ automated match to d4r17h_ complexed with 39v, cl, mes, mg |
PDB Entry: 5l5h (more details), 2.6 Å
SCOPe Domain Sequences for d5l5hv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5hv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l5hv_:
View in 3D Domains from other chains: (mouse over for more information) d5l5ha_, d5l5hb_, d5l5hc1, d5l5hc2, d5l5hd_, d5l5he_, d5l5hf_, d5l5hg_, d5l5hh_, d5l5hi_, d5l5hj_, d5l5hk_, d5l5hl_, d5l5hm_, d5l5hn_, d5l5ho_, d5l5hp_, d5l5hq1, d5l5hq2, d5l5hr_, d5l5hs_, d5l5ht_, d5l5hu_, d5l5hw_, d5l5hx_, d5l5hy_, d5l5hz_ |