Lineage for d5l5op_ (5l5o P:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229331Domain d5l5op_: 5l5o P: [325470]
    Other proteins in same PDB: d5l5oa_, d5l5oc_, d5l5od_, d5l5oe_, d5l5og_, d5l5oi_, d5l5oj_, d5l5ok_, d5l5ol_, d5l5on_, d5l5oo_, d5l5oq_, d5l5or_, d5l5os_, d5l5ou_, d5l5ow_, d5l5ox_, d5l5oy_, d5l5oz_
    automated match to d1z7qc1
    complexed with 79p, cl, mes, mg

Details for d5l5op_

PDB Entry: 5l5o (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l5op_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5op_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l5op_:

Click to download the PDB-style file with coordinates for d5l5op_.
(The format of our PDB-style files is described here.)

Timeline for d5l5op_: