Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l5op_: 5l5o P: [325470] Other proteins in same PDB: d5l5oa_, d5l5oc_, d5l5od_, d5l5oe_, d5l5og_, d5l5oi_, d5l5oj_, d5l5ok_, d5l5ol_, d5l5on_, d5l5oo_, d5l5oq_, d5l5or_, d5l5os_, d5l5ou_, d5l5ow_, d5l5ox_, d5l5oy_, d5l5oz_ automated match to d1z7qc1 complexed with 79p, cl, mes, mg |
PDB Entry: 5l5o (more details), 2.6 Å
SCOPe Domain Sequences for d5l5op_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5op_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l5op_: