Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l5wb_: 5l5w B: [325427] Other proteins in same PDB: d5l5wa_, d5l5wc1, d5l5wc2, d5l5wd_, d5l5we_, d5l5wg_, d5l5wi_, d5l5wj_, d5l5wk_, d5l5wl_, d5l5wo_, d5l5wq1, d5l5wq2, d5l5wr_, d5l5ws_, d5l5wu_, d5l5ww_, d5l5wx_, d5l5wy_, d5l5wz_ automated match to d1z7qc1 complexed with cl, mg |
PDB Entry: 5l5w (more details), 2.8 Å
SCOPe Domain Sequences for d5l5wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5wb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l5wb_:
View in 3D Domains from other chains: (mouse over for more information) d5l5wa_, d5l5wc1, d5l5wc2, d5l5wd_, d5l5we_, d5l5wf_, d5l5wg_, d5l5wh_, d5l5wi_, d5l5wj_, d5l5wk_, d5l5wl_, d5l5wm_, d5l5wn_, d5l5wo_, d5l5wp_, d5l5wq1, d5l5wq2, d5l5wr_, d5l5ws_, d5l5wt_, d5l5wu_, d5l5wv_, d5l5ww_, d5l5wx_, d5l5wy_, d5l5wz_ |