Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l5ur_: 5l5u R: [325394] Other proteins in same PDB: d5l5ua_, d5l5ub_, d5l5uc2, d5l5uf_, d5l5ug_, d5l5uh_, d5l5ui_, d5l5uj_, d5l5uk_, d5l5ul_, d5l5um_, d5l5un_, d5l5uo_, d5l5up_, d5l5uq2, d5l5ut_, d5l5uu_, d5l5uv_, d5l5uw_, d5l5ux_, d5l5uy_, d5l5uz_ automated match to d1iruf_ complexed with 04c, cl, mg |
PDB Entry: 5l5u (more details), 2.6 Å
SCOPe Domain Sequences for d5l5ur_:
Sequence, based on SEQRES records: (download)
>d5l5ur_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
>d5l5ur_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
Timeline for d5l5ur_:
View in 3D Domains from other chains: (mouse over for more information) d5l5ua_, d5l5ub_, d5l5uc1, d5l5uc2, d5l5ud_, d5l5ue_, d5l5uf_, d5l5ug_, d5l5uh_, d5l5ui_, d5l5uj_, d5l5uk_, d5l5ul_, d5l5um_, d5l5un_, d5l5uo_, d5l5up_, d5l5uq1, d5l5uq2, d5l5us_, d5l5ut_, d5l5uu_, d5l5uv_, d5l5uw_, d5l5ux_, d5l5uy_, d5l5uz_ |