Lineage for d5l5oh_ (5l5o H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994255Domain d5l5oh_: 5l5o H: [325393]
    Other proteins in same PDB: d5l5oa_, d5l5oc1, d5l5oc2, d5l5od_, d5l5oe_, d5l5og_, d5l5oi_, d5l5oj_, d5l5ok_, d5l5ol_, d5l5on_, d5l5oo_, d5l5oq1, d5l5oq2, d5l5or_, d5l5os_, d5l5ou_, d5l5ow_, d5l5ox_, d5l5oy_, d5l5oz_
    automated match to d4r17h_
    complexed with 79p, cl, mes, mg

Details for d5l5oh_

PDB Entry: 5l5o (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5oh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l5oh_:

Click to download the PDB-style file with coordinates for d5l5oh_.
(The format of our PDB-style files is described here.)

Timeline for d5l5oh_: