Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l5pv_: 5l5p V: [325362] Other proteins in same PDB: d5l5pa_, d5l5pc_, d5l5pd_, d5l5pe_, d5l5pg_, d5l5pi_, d5l5pj_, d5l5pk_, d5l5pl_, d5l5pn_, d5l5po_, d5l5pq_, d5l5pr_, d5l5ps_, d5l5pu_, d5l5pw_, d5l5px_, d5l5py_, d5l5pz_ automated match to d4r17h_ complexed with 79l, cl, mes, mg |
PDB Entry: 5l5p (more details), 2.8 Å
SCOPe Domain Sequences for d5l5pv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5pv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l5pv_: