Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d5l5wc_: 5l5w C: [325297] Other proteins in same PDB: d5l5wa_, d5l5wb_, d5l5wf_, d5l5wh_, d5l5wi_, d5l5wj_, d5l5wk_, d5l5wl_, d5l5wm_, d5l5wn_, d5l5wo_, d5l5wp_, d5l5wt_, d5l5wv_, d5l5ww_, d5l5wx_, d5l5wy_, d5l5wz_ automated match to d1iruf_ complexed with cl, mg |
PDB Entry: 5l5w (more details), 2.8 Å
SCOPe Domain Sequences for d5l5wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5wc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5l5wc_: