Lineage for d5l5qe_ (5l5q E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (15 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2555128Domain d5l5qe_: 5l5q E: [325289]
    Other proteins in same PDB: d5l5qa_, d5l5qb_, d5l5qf_, d5l5qg_, d5l5qh_, d5l5qi_, d5l5qj_, d5l5qk_, d5l5ql_, d5l5qm_, d5l5qn_, d5l5qo_, d5l5qp_, d5l5qt_, d5l5qu_, d5l5qv_, d5l5qw_, d5l5qx_, d5l5qy_, d5l5qz_
    automated match to d4g4se_
    complexed with 6nv, cl, mes, mg

Details for d5l5qe_

PDB Entry: 5l5q (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone 18
PDB Compounds: (E:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5qe_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l5qe_:

Click to download the PDB-style file with coordinates for d5l5qe_.
(The format of our PDB-style files is described here.)

Timeline for d5l5qe_: