SCOPe 2.08: Domain d5l5df_: 5l5d F:

Lineage for d5l5df_ (5l5d F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)

8. Domain d5l5df_: 5l5d F: [325218]
   Other proteins in same PDB: d5l5da_, d5l5dc2, d5l5dh_, d5l5di_, d5l5dj_, d5l5dm_, d5l5dn_, d5l5do_, d5l5dq2, d5l5dv_, d5l5dw_, d5l5dx_
   automated match to d4g4sg_
   complexed with 04c, cl, mes, mg

Details for d5l5df_

PDB Entry: 5l5d, 2.8 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with onx 0914

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l5df_:

Sequence; same for both SEQRES and ATOM records:

>d5l5df_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d5l5df_:

• d5l5df_ first appeared in SCOPe 2.06
  
• d5l5df_ appears in SCOPe 2.07