SCOPe 2.08: Domain d5l55m_: 5l55 M:

Lineage for d5l55m_ (5l55 M:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d5l55m_: 5l55 M: [325213]
   Other proteins in same PDB: d5l55b_, d5l55c1, d5l55c2, d5l55d_, d5l55e_, d5l55f_, d5l55g_, d5l55h_, d5l55p_, d5l55q1, d5l55q2, d5l55r_, d5l55s_, d5l55t_, d5l55u_, d5l55v_
   automated match to d4qz7m_
   complexed with 6nv, cl, mes, mg

Details for d5l55m_

PDB Entry: 5l55, 2.9 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 18

PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5l55m_:

Sequence; same for both SEQRES and ATOM records:

>d5l55m_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgy

Timeline for d5l55m_:

• d5l55m_ first appeared in SCOPe 2.06
  
• d5l55m_ appears in SCOPe 2.07