Lineage for d5l5xs_ (5l5x S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230913Domain d5l5xs_: 5l5x S: [325162]
    Other proteins in same PDB: d5l5xa_, d5l5xb_, d5l5xf_, d5l5xg_, d5l5xh_, d5l5xi_, d5l5xj_, d5l5xk_, d5l5xl_, d5l5xm_, d5l5xn_, d5l5xo_, d5l5xp_, d5l5xt_, d5l5xu_, d5l5xv_, d5l5xw_, d5l5xx_, d5l5xy_, d5l5xz_
    automated match to d4g4se_
    complexed with 04c, cl, mes, mg

Details for d5l5xs_

PDB Entry: 5l5x (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with onx 0914
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5xs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5xs_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l5xs_:

Click to download the PDB-style file with coordinates for d5l5xs_.
(The format of our PDB-style files is described here.)

Timeline for d5l5xs_: