Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d5l5xs_: 5l5x S: [325162] Other proteins in same PDB: d5l5xa_, d5l5xb_, d5l5xf_, d5l5xg_, d5l5xh_, d5l5xi_, d5l5xj_, d5l5xk_, d5l5xl_, d5l5xm_, d5l5xn_, d5l5xo_, d5l5xp_, d5l5xt_, d5l5xu_, d5l5xv_, d5l5xw_, d5l5xx_, d5l5xy_, d5l5xz_ automated match to d4g4se_ complexed with 04c, cl, mes, mg |
PDB Entry: 5l5x (more details), 2.9 Å
SCOPe Domain Sequences for d5l5xs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5xs_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l5xs_: