Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries) |
Domain d5l55c1: 5l55 C:1-234 [325072] Other proteins in same PDB: d5l55a_, d5l55c2, d5l55h_, d5l55i_, d5l55j_, d5l55k_, d5l55l_, d5l55m_, d5l55n_, d5l55o_, d5l55q2, d5l55v_, d5l55w_, d5l55x_, d5l55y_, d5l55z_ automated match to d1iruf_ complexed with 6nv, cl, mes, mg |
PDB Entry: 5l55 (more details), 2.9 Å
SCOPe Domain Sequences for d5l55c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l55c1 d.153.1.4 (C:1-234) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d5l55c1:
View in 3D Domains from other chains: (mouse over for more information) d5l55a_, d5l55b_, d5l55d_, d5l55e_, d5l55f_, d5l55g_, d5l55h_, d5l55i_, d5l55j_, d5l55k_, d5l55l_, d5l55m_, d5l55n_, d5l55o_, d5l55p_, d5l55q1, d5l55q2, d5l55r_, d5l55s_, d5l55t_, d5l55u_, d5l55v_, d5l55w_, d5l55x_, d5l55y_, d5l55z_ |