Lineage for d5l55c1 (5l55 C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990638Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2990726Domain d5l55c1: 5l55 C:1-234 [325072]
    Other proteins in same PDB: d5l55a_, d5l55c2, d5l55h_, d5l55i_, d5l55j_, d5l55k_, d5l55l_, d5l55m_, d5l55n_, d5l55o_, d5l55q2, d5l55v_, d5l55w_, d5l55x_, d5l55y_, d5l55z_
    automated match to d1iruf_
    complexed with 6nv, cl, mes, mg

Details for d5l55c1

PDB Entry: 5l55 (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 18
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l55c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l55c1 d.153.1.4 (C:1-234) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d5l55c1:

Click to download the PDB-style file with coordinates for d5l55c1.
(The format of our PDB-style files is described here.)

Timeline for d5l55c1: