Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (49 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [256773] (14 PDB entries) |
Domain d5kj5a_: 5kj5 A: [325062] automated match to d4lihb_ complexed with nad |
PDB Entry: 5kj5 (more details), 2.11 Å
SCOPe Domain Sequences for d5kj5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kj5a_ c.82.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]} sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht dlfemstsdgsgalnytvrkplgvigvispwdlplllftwkvapalacgntvvakpsees pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic iki
Timeline for d5kj5a_: