Lineage for d5kj5a_ (5kj5 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482618Species Pseudomonas fluorescens [TaxId:294] [256773] (14 PDB entries)
  8. 2482651Domain d5kj5a_: 5kj5 A: [325062]
    automated match to d4lihb_
    complexed with nad

Details for d5kj5a_

PDB Entry: 5kj5 (more details), 2.11 Å

PDB Description: crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase n169d in complex with nad+
PDB Compounds: (A:) 2-aminomuconate 6-semialdehyde dehydrogenase

SCOPe Domain Sequences for d5kj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kj5a_ c.82.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
dlfemstsdgsgalnytvrkplgvigvispwdlplllftwkvapalacgntvvakpsees
pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
iki

SCOPe Domain Coordinates for d5kj5a_:

Click to download the PDB-style file with coordinates for d5kj5a_.
(The format of our PDB-style files is described here.)

Timeline for d5kj5a_: