Lineage for d5l5xb_ (5l5x B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229766Domain d5l5xb_: 5l5x B: [325046]
    Other proteins in same PDB: d5l5xa_, d5l5xc_, d5l5xd_, d5l5xe_, d5l5xg_, d5l5xi_, d5l5xj_, d5l5xk_, d5l5xl_, d5l5xn_, d5l5xo_, d5l5xq_, d5l5xr_, d5l5xs_, d5l5xu_, d5l5xw_, d5l5xx_, d5l5xy_, d5l5xz_
    automated match to d1z7qc1
    complexed with 04c, cl, mes, mg

Details for d5l5xb_

PDB Entry: 5l5x (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with onx 0914
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l5xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5xb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l5xb_:

Click to download the PDB-style file with coordinates for d5l5xb_.
(The format of our PDB-style files is described here.)

Timeline for d5l5xb_: