![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
![]() | Protein automated matches [190509] (19 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
![]() | Domain d5l5xr_: 5l5x R: [325020] Other proteins in same PDB: d5l5xa_, d5l5xb_, d5l5xc2, d5l5xf_, d5l5xg_, d5l5xh_, d5l5xi_, d5l5xj_, d5l5xk_, d5l5xl_, d5l5xm_, d5l5xn_, d5l5xo_, d5l5xp_, d5l5xq2, d5l5xt_, d5l5xu_, d5l5xv_, d5l5xw_, d5l5xx_, d5l5xy_, d5l5xz_ automated match to d1iruf_ complexed with 04c, cl, mes, mg |
PDB Entry: 5l5x (more details), 2.9 Å
SCOPe Domain Sequences for d5l5xr_:
Sequence, based on SEQRES records: (download)
>d5l5xr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
>d5l5xr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
Timeline for d5l5xr_:
![]() Domains from other chains: (mouse over for more information) d5l5xa_, d5l5xb_, d5l5xc1, d5l5xc2, d5l5xd_, d5l5xe_, d5l5xf_, d5l5xg_, d5l5xh_, d5l5xi_, d5l5xj_, d5l5xk_, d5l5xl_, d5l5xm_, d5l5xn_, d5l5xo_, d5l5xp_, d5l5xq1, d5l5xq2, d5l5xs_, d5l5xt_, d5l5xu_, d5l5xv_, d5l5xw_, d5l5xx_, d5l5xy_, d5l5xz_ |