Lineage for d5jv5b1 (5jv5 B:1-199)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891394Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2891405Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)
  8. 2891423Domain d5jv5b1: 5jv5 B:1-199 [325004]
    Other proteins in same PDB: d5jv5a2, d5jv5b2
    automated match to d1p17b_
    complexed with 5gp, mg, so4

Details for d5jv5b1

PDB Entry: 5jv5 (more details), 2.73 Å

PDB Description: trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with guanosine 5' monophosphate
PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5jv5b1:

Sequence, based on SEQRES records: (download)

>d5jv5b1 c.61.1.1 (B:1-199) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
mepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvft
admvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtal
tlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyre
vrdvvilkpsvyetwgkel

Sequence, based on observed residues (ATOM records): (download)

>d5jv5b1 c.61.1.1 (B:1-199) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
mepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvft
admvrilgdfgvptrvefldirgkhvlvledildtaltlrevvdslkksepasiktlvai
dkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkel

SCOPe Domain Coordinates for d5jv5b1:

Click to download the PDB-style file with coordinates for d5jv5b1.
(The format of our PDB-style files is described here.)

Timeline for d5jv5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jv5b2