Lineage for d5gm0a2 (5gm0 A:145-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781368Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)
  8. 2781370Domain d5gm0a2: 5gm0 A:145-278 [324881]
    Other proteins in same PDB: d5gm0a3, d5gm0b3
    automated match to d4hl0a2

Details for d5gm0a2

PDB Entry: 5gm0 (more details), 1.7 Å

PDB Description: tl-gal with lactose
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d5gm0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gm0a2 b.29.1.0 (A:145-278) automated matches {Toxascaris leonina [TaxId: 59264]}
yypvpyesglagdglapgksllifatpekkgkrfhinllkkngdialhfnprfdekaivr
nslisgewgneeregknplekgigcdlefrneeyafqiyvdgerfatyahrldphdingl
qiggdvevtgiqmv

SCOPe Domain Coordinates for d5gm0a2:

Click to download the PDB-style file with coordinates for d5gm0a2.
(The format of our PDB-style files is described here.)

Timeline for d5gm0a2: