Lineage for d5g18a_ (5g18 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244557Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (26 PDB entries)
  8. 2244566Domain d5g18a_: 5g18 A: [324864]
    automated match to d2zq7a_
    complexed with azr, so4

Details for d5g18a_

PDB Entry: 5g18 (more details), 1.1 Å

PDB Description: direct observation of active-site protonation states in a class a beta lactamase with a monobactam substrate
PDB Compounds: (A:) beta-lactamase ctx-m-97

SCOPe Domain Sequences for d5g18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g18a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaenrndilaaaakivthgf

SCOPe Domain Coordinates for d5g18a_:

Click to download the PDB-style file with coordinates for d5g18a_.
(The format of our PDB-style files is described here.)

Timeline for d5g18a_: