SCOPe 2.08: Domain d5ektb_: 5ekt B:

Lineage for d5ektb_ (5ekt B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries)

8. Domain d5ektb_: 5ekt B: [324863]
   automated match to d4y2zb_
   complexed with flc; mutant

Details for d5ektb_

PDB Entry: 5ekt, 1.63 Å

PDB Description: crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.

PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5ektb_:

Sequence; same for both SEQRES and ATOM records:

>d5ektb_ c.56.3.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
elrvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
kdtisklgnnkefyrlrlgighpghadkvagyvlgkapakeqexldaavdesvrcleilm
kdgltkaqnrlhtfkae

Timeline for d5ektb_:

• d5ektb_ first appeared in SCOPe 2.06
  
• d5ektb_ appears in SCOPe 2.07