Lineage for d5ektb_ (5ekt B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889378Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries)
  8. 2889382Domain d5ektb_: 5ekt B: [324863]
    automated match to d4y2zb_
    complexed with flc; mutant

Details for d5ektb_

PDB Entry: 5ekt (more details), 1.63 Å

PDB Description: crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5ektb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ektb_ c.56.3.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
elrvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
kdtisklgnnkefyrlrlgighpghadkvagyvlgkapakeqexldaavdesvrcleilm
kdgltkaqnrlhtfkae

SCOPe Domain Coordinates for d5ektb_:

Click to download the PDB-style file with coordinates for d5ektb_.
(The format of our PDB-style files is described here.)

Timeline for d5ektb_: