Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein Acetylcholinesterase [53476] (5 species) |
Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (87 PDB entries) Uniprot P04058 25-556 |
Domain d5ehxa_: 5ehx A: [324853] automated match to d1jjba_ complexed with 03s, ae4, nag |
PDB Entry: 5ehx (more details), 2.1 Å
SCOPe Domain Sequences for d5ehxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ehxa_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
Timeline for d5ehxa_: