SCOPe 2.06: Domain d5ktwb1: 5ktw B:1085-1196

Lineage for d5ktwb1 (5ktw B:1085-1196)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)

8. Domain d5ktwb1: 5ktw B:1085-1196 [324821]
   Other proteins in same PDB: d5ktwa2, d5ktwb2, d5ktwc2
   automated match to d4nyxa_
   complexed with 6xg, edo

Details for d5ktwb1

PDB Entry: 5ktw, 1.09 Å

PDB Description: crebbp bromodomain in complex with cpd 44 (3-((5-acetyl-1- (cyclopropylmethyl)-4,5,6,7-tetrahydro-1h-pyrazolo[4,3-c]pyridin-3- yl)amino)-n-isopropylbenzamide)

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d5ktwb1:

Sequence; same for both SEQRES and ATOM records:

>d5ktwb1 a.29.2.1 (B:1085-1196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal

Timeline for d5ktwb1:

• d5ktwb1 is new in SCOPe 2.06-stable
  
• d5ktwb1 appears in SCOPe 2.07
  
• d5ktwb1 appears in the current release, SCOPe 2.08