SCOPe 2.08: Domain d5djma1: 5djm A:1-78

Lineage for d5djma1 (5djm A:1-78)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d5djma1: 5djm A:1-78 [324819]
   Other proteins in same PDB: d5djma2, d5djmb2
   automated match to d3hkrb1
   complexed with mes, pt

Details for d5djma1

PDB Entry: 5djm, 1.9 Å

PDB Description: structure of wt human glutathione transferase in complex with cisplatin in the absence of glutathione.

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5djma1:

Sequence, based on SEQRES records:

>d5djma1 c.47.1.5 (A:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

Sequence, based on observed residues (ATOM records):

>d5djma1 c.47.1.5 (A:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvsclygqlpkfqdgdltlyqsntilr
hlgrtlgl

Timeline for d5djma1:

• d5djma1 first appeared in SCOPe 2.06
  
• d5djma1 appears in SCOPe 2.07