Lineage for d5kndd1 (5knd D:4-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798908Species Enterococcus hirae [TaxId:768486] [324658] (7 PDB entries)
  8. 2798912Domain d5kndd1: 5knd D:4-75 [324807]
    Other proteins in same PDB: d5kndd2, d5kndd3, d5knde2, d5knde3, d5kndf2, d5kndf3, d5kndg_
    automated match to d3vr2d1
    complexed with b3p, gol, mg, po4

Details for d5kndd1

PDB Entry: 5knd (more details), 2.89 Å

PDB Description: crystal structure of the pi-bound v1 complex
PDB Compounds: (D:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5kndd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kndd1 b.49.1.0 (D:4-75) automated matches {Enterococcus hirae [TaxId: 768486]}
eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi
nlknssvrflgh

SCOPe Domain Coordinates for d5kndd1:

Click to download the PDB-style file with coordinates for d5kndd1.
(The format of our PDB-style files is described here.)

Timeline for d5kndd1: